McDonnell Genome Institute

Washington University

Transcript

lnc-RWDD4-2:10

Chromosome

chr4

Gene Name

lnc-RWDD4-2

Start

183461324

CPC Label

noncoding

End

183504524

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

EQQAVPFR

Modified Peptide

n[145]EQQAVPFR

Peptide Length

8

ORF Length

110

Open Reading Frame (ORF)

LGGAAPAPLGSLRPATPAFSPSGGPSAAPREPAKEQQAVPFRTTWSEACGTARPGGRRAAPGMRGGCVPAASELAWGCRPPPAGPSGSPGTAGLDQGEMISSGKRLRKSA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.146015

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9965

PhyloCSF Frame 3

0.139

CNTI Score

-0.294063202