McDonnell Genome Institute

Washington University

Transcript

lnc-RWDD2B-3:1

Chromosome

chr21

Gene Name

lnc-RWDD2B-3

Start

28998369

CPC Label

noncoding

End

29003167

Cancer

OSCC

Strand

-

Peptide

LHVCICGVFFK

Modified Peptide

n[145]LHVCICGVFFK

Peptide Length

11

ORF Length

51

Open Reading Frame (ORF)

LHVCICGVFFKKKKNKLGRVRRLTPVISPLWEAKVGGSPEVRSSRPAWPTW

Conservation Score

0.178

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.105405

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.705

PhyloCSF Frame 3

0

CNTI Score

-0.267467505