McDonnell Genome Institute

Washington University

Transcript

lnc-RUVBL1-1:6

Chromosome

chr3

Gene Name

lnc-RUVBL1-1

Start

127852490

CPC Label

noncoding

End

128052175

Cancer

OV

Strand

-

Peptide

LGLCGLTEK

Modified Peptide

n[145]LGLCGLTEK

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

LGLCGLTEKLRQARSVECARGPAGRRRPWWLPYT

Conservation Score

0.026

PhyloCSF Frame 1

-4.707

No. of Spectra

36

CPC Coding Probability

0.0186658

PhyloCSF Frame 2 

-4.599

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

-3.468

CNTI Score

-0.372285343