McDonnell Genome Institute

Washington University

Transcript

lnc-RUNX3-1:1

Chromosome

chr1

Gene Name

lnc-RUNX3-1

Start

24968422

CPC Label

noncoding

End

24970865

Cancer

OV

Strand

-

Peptide

TSLEIMPVLGQFAHR

Modified Peptide

n[145]TSLEIMPVLGQFAHR

Peptide Length

15

ORF Length

98

Open Reading Frame (ORF)

LAGPSLECHISSHQPLNRQLTRRELECVPTSWCQLGLHGYRTSLEIMPVLGQFAHRSALLIPLFGSVTQGFDGTGCIPRAPWPAGPRYIQPMGGTKRR

Conservation Score

0.616

PhyloCSF Frame 1

-2.555

No. of Spectra

22

CPC Coding Probability

0.194172

PhyloCSF Frame 2 

-3.083

CNTI Index

noncoding

Max Probability

0.7943

PhyloCSF Frame 3

-2.844

CNTI Score

-0.360845419