McDonnell Genome Institute

Washington University

Transcript

lnc-RUNX1T1-3:1

Chromosome

chr8

Gene Name

lnc-RUNX1T1-3

Start

91542923

CPC Label

noncoding

End

91907619

Cancer

OV

Strand

-

Peptide

SQSLILVLPSCK

Modified Peptide

n[145]SQSLILVLPSCK

Peptide Length

12

ORF Length

84

Open Reading Frame (ORF)

LKISTMLRSFLYLFELIQHFKNGNRNFIYIIPASTQEEYGKTSDIPSRTLAGFVILGRSQSLILVLPSCKMGIILSPYPYHRWL

Conservation Score

0.492

PhyloCSF Frame 1

-5.534

No. of Spectra

1

CPC Coding Probability

0.18238

PhyloCSF Frame 2 

-5.261

CNTI Index

noncoding

Max Probability

0.8643

PhyloCSF Frame 3

-5.964

CNTI Score

-0.399078253