McDonnell Genome Institute

Washington University

Transcript

lnc-RUNX1-12:1

Chromosome

chr21

Gene Name

lnc-RUNX1-12

Start

35954678

CPC Label

noncoding

End

36004667

Cancer

OV

Strand

-

Peptide

LYPQMLMIK

Modified Peptide

n[145]LYPQM[147]LMIK

Peptide Length

9

ORF Length

79

Open Reading Frame (ORF)

LYPQMLMIKNKCDRDQQLCVQVQTLPLGKARDLPVPQVLAEWKCPLHRMAEGVDERWTLLPGTHGCSRRLCFTVGCNMS

Conservation Score

0.014

PhyloCSF Frame 1

-3.946

No. of Spectra

1

CPC Coding Probability

0.0482927

PhyloCSF Frame 2 

-4.941

CNTI Index

noncoding

Max Probability

0.4102

PhyloCSF Frame 3

-5.136

CNTI Score

-0.360183395