McDonnell Genome Institute

Washington University

Transcript

lnc-RUNX1-1:1

Chromosome

chr21

Gene Name

lnc-RUNX1-1

Start

36005158

CPC Label

noncoding

End

36008601

Cancer

EOGC

Strand

-

Peptide

STLMLSAR

Modified Peptide

n[145]STLMLSAR

Peptide Length

8

ORF Length

44

Open Reading Frame (ORF)

LHSFCIPYVSTRQRDVSKIRAKKNSAKEKSTLMLSARLLDWSEP

Conservation Score

0.876

PhyloCSF Frame 1

0

No. of Spectra

82

CPC Coding Probability

0.0684467

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.380082679