McDonnell Genome Institute

Washington University

Transcript

lnc-RUNDC3B-4:1

Chromosome

chr7

Gene Name

lnc-RUNDC3B-4

Start

87521460

CPC Label

coding

End

87522410

Cancer

OV

Strand

+

Peptide

LEAEALAPMLVQASTLPNHETK

Modified Peptide

n[145]LEAEALAPMLVQASTLPNHETK

Peptide Length

22

ORF Length

39

Open Reading Frame (ORF)

LEAEALAPMLVQASTLPNHETKVAMAVPVAAVATAVAED

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

32

CPC Coding Probability

0.609575

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8519

PhyloCSF Frame 3

0

CNTI Score

-0.315705055