McDonnell Genome Institute

Washington University

Transcript

lnc-RUNDC1-3:1

Chromosome

chr17

Gene Name

lnc-RUNDC1-3

Start

42964514

CPC Label

noncoding

End

42966943

Cancer

PRAD

Strand

+

Peptide

GLVSPLGPQGCK

Modified Peptide

GLVSPLGPQGCK

Peptide Length

12

ORF Length

142

Open Reading Frame (ORF)

LSAQKQEGKEWNAVWINLLKTRIAYLLGCLTTVLRLYKGQDQEEKNKQTKTKKRDLDKARGLVSPLGPQGCKYSGCGIPAHRGGDGTGMVTEQHCPVEIESKELGEVAHACNPSILGGRGGWITSGQEFETSLANIAKLRLY

Conservation Score

0.917

PhyloCSF Frame 1

0

No. of Spectra

25

CPC Coding Probability

0.0322241

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

0.635802621