McDonnell Genome Institute

Washington University

Transcript

lnc-RUBCN-2:4

Chromosome

chr3

Gene Name

lnc-RUBCN-2

Start

197629612

CPC Label

coding

End

197651805

Cancer

OV

Strand

-

Peptide

EQHGALGAANAHDTVR

Modified Peptide

n[145]EQHGALGAANAHDTVR

Peptide Length

16

ORF Length

198

Open Reading Frame (ORF)

LPWLAQLNAPLEQDLVLDTQRPLVEGLPPGVATDTSTFGSHTAGRPRDLLCLPFSLVAFLKFVPSQVCPIRKTKHLSLLHGNPRQHLLLTHRASRQHHSPNLPTRTSSWDPLMDQDSASTKTCPGTHRKSGPRSREQHGALGAANAHDTVRDGERYDRWSGPRRREQHGALGAANAPDTVRDGERYGHGGHKMLLNIY

Conservation Score

0.315

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.582771

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8175

PhyloCSF Frame 3

0

CNTI Score

-0.321952792