McDonnell Genome Institute

Washington University

Transcript

lnc-RUBCN-2:1

Chromosome

chr3

Gene Name

lnc-RUBCN-2

Start

197649144

CPC Label

noncoding

End

197654794

Cancer

EOGC

Strand

-

Peptide

CPTRASCGTSSRAATWHRPGTSR

Modified Peptide

n[145]CPTRASCGTSSRAATWHRPGTSR

Peptide Length

23

ORF Length

240

Open Reading Frame (ORF)

LALGRLLLPPRPWAALGLLRARRCPTRASCGTSSRAATWHRPGTSRLPRSCPGPVSRPPRPTPFPAGCPAASPVTCRVPSGLPRPLPRPPPSPPPLPGPPRAPPNPTPTDAAAPIPCPDPRGRPHPLPGPPRSPPSAARSPGAAPASCPVPVLCVGPFPRCRGRHCRPEVAATGSWARPCFSPRAVGGGSPGCLFGESGNRLSGPLLKCQQPRKKQRPGVCSGQVTFMAAPSVPGRFSTE

Conservation Score

0.871

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.241337

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.0792

PhyloCSF Frame 3

0

CNTI Score

0.72214011