McDonnell Genome Institute

Washington University

Transcript

lnc-RTP5-9:2

Chromosome

chr2

Gene Name

lnc-RTP5-9

Start

241889049

CPC Label

noncoding

End

241891500

Cancer

EOGC

Strand

+

Peptide

AVSLPSCGHQPQPPSGGHPGSISPGEK

Modified Peptide

n[145]AVSLPSCGHQPQPPSGGHPGSISPGEK

Peptide Length

27

ORF Length

62

Open Reading Frame (ORF)

LVSMAGKAVSLPSCGHQPQPPSGGHPGSISPGEKYRSFTFPGYVPAEMFTVNPATCGADFHF

Conservation Score

0.024

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.202793

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1092

PhyloCSF Frame 3

0

CNTI Score

-0.320990403