McDonnell Genome Institute

Washington University

Transcript

lnc-RTP5-1:3

Chromosome

chr2

Gene Name

lnc-RTP5-1

Start

241844088

CPC Label

noncoding

End

241846517

Cancer

OV

Strand

+

Peptide

LGHGAGPR

Modified Peptide

n[145]LGHGAGPR

Peptide Length

8

ORF Length

78

Open Reading Frame (ORF)

LGHGAGPRLSRSGSHAPRPPPGTVPRGAPRPGHTQGAPEAAAAAVRGRADPPGARGWGGSAAAARRRHRPGASRGRKK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0697724

PhyloCSF Frame 2 

-2.336

CNTI Index

noncoding

Max Probability

0.9859

PhyloCSF Frame 3

0

CNTI Score

-0.283326204