McDonnell Genome Institute

Washington University

Transcript

lnc-RTP4-6:1

Chromosome

chr3

Gene Name

lnc-RTP4-6

Start

187738135

CPC Label

noncoding

End

187745462

Cancer

CCRC

Strand

+

Peptide

SLGRPGWTGLSLCK

Modified Peptide

n[230]SLGRPGWTGLSLCK

Peptide Length

14

ORF Length

158

Open Reading Frame (ORF)

LGNGRVQETTVNKSEFDNAMASTAALDNRGVRGHCVLTFISITFPANSALASLQASRKCNKTEGCVLSSRSEEELQKGRSPYAQRETAFQKGPKTMPANRVPEQRSLGRPGWTGLSLCKKAGGGGEKHDLLKQTMPLKIRSGKKSAKVLIHVNEDGRH

Conservation Score

1

PhyloCSF Frame 1

-2.256

No. of Spectra

4

CPC Coding Probability

0.42227

PhyloCSF Frame 2 

-3.43

CNTI Index

noncoding

Max Probability

0.995

PhyloCSF Frame 3

-0.416

CNTI Score

-0.292165776