McDonnell Genome Institute

Washington University

Transcript

lnc-RTN4R-1:6

Chromosome

chr22

Gene Name

lnc-RTN4R-1

Start

20211037

CPC Label

noncoding

End

20212147

Cancer

LUAD

Strand

-

Peptide

LGQHQPR

Modified Peptide

n[230]LGQHQPR

Peptide Length

7

ORF Length

44

Open Reading Frame (ORF)

LGRLGQHQPRKPPLQSPVLCPSGPGLASLSIWGQGGSLGTRHLE

Conservation Score

0.035

PhyloCSF Frame 1

-5.536

No. of Spectra

13

CPC Coding Probability

0.0799345

PhyloCSF Frame 2 

-4.356

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-5.291

CNTI Score

-0.284295238