McDonnell Genome Institute

Washington University

Transcript

lnc-RTN4R-1:3

Chromosome

chr22

Gene Name

lnc-RTN4R-1

Start

20198569

CPC Label

noncoding

End

20212147

Cancer

OV

Strand

-

Peptide

TVTGPGWAPVSR

Modified Peptide

n[145]TVTGPGWAPVSR

Peptide Length

12

ORF Length

171

Open Reading Frame (ORF)

LLRGADRKQGGTRTVTGPGWAPVSRASTGGLQGFSAIKSIIQRQRSWGLAHRVPVMRRGCPCRNAPEAATRERVTRTTSVDLAGPRAPFKIVPGESPWRCSGGSWSPTLLTGETTQLLRGKTAEEHVRTVPSATKAAPESGTAVRGGTCPGSLMGTHSPLHPQRGTCPNEN

Conservation Score

1

PhyloCSF Frame 1

-3.76

No. of Spectra

1

CPC Coding Probability

0.158882

PhyloCSF Frame 2 

1.106

CNTI Index

noncoding

Max Probability

0.8562

PhyloCSF Frame 3

-0.433

CNTI Score

-0.31583611