McDonnell Genome Institute

Washington University

Transcript

lnc-RTN4IP1-4:1

Chromosome

chr6

Gene Name

lnc-RTN4IP1-4

Start

106283414

CPC Label

noncoding

End

106283711

Cancer

OV

Strand

-

Peptide

LSPGVLGR

Modified Peptide

n[145]LSPGVLGR

Peptide Length

8

ORF Length

53

Open Reading Frame (ORF)

LLSQLLRRLRWEERLSPGVLGRSVLCRLNFHTKFSINTVTSWEQETTRLPKER

Conservation Score

0.099

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00945908

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8559

PhyloCSF Frame 3

0

CNTI Score

-0.367199125