McDonnell Genome Institute

Washington University

Transcript

lnc-RTN4-5:1

Chromosome

chr2

Gene Name

lnc-RTN4-5

Start

54718276

CPC Label

noncoding

End

54723378

Cancer

LUAD

Strand

-

Peptide

GGNSSQPPYFSSEK

Modified Peptide

n[230]GGNSSQPPYFSSEK

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

LLYSFPILGYRKVGRGGNSSQPPYFSSEKISSFLDKVGRM

Conservation Score

0.129

PhyloCSF Frame 1

-5.18

No. of Spectra

1

CPC Coding Probability

0.224006

PhyloCSF Frame 2 

-5.258

CNTI Index

noncoding

Max Probability

0.6403

PhyloCSF Frame 3

-4.937

CNTI Score

-0.360713719