McDonnell Genome Institute

Washington University

Transcript

lnc-RTL8B-2:2

Chromosome

chrX

Gene Name

lnc-RTL8B-2

Start

135050932

CPC Label

noncoding

End

135051271

Cancer

OV

Strand

-

Peptide

DLLCSCHIAAR

Modified Peptide

n[145]DLLCSCHIAAR

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

LDSDPDSWPSPKEPVTFSETHFLPIPRDLLCSCHIAARA

Conservation Score

0.93

PhyloCSF Frame 1

-4.737

No. of Spectra

6

CPC Coding Probability

0.00335844

PhyloCSF Frame 2 

-3.235

CNTI Index

noncoding

Max Probability

0.9277

PhyloCSF Frame 3

-0.351

CNTI Score

-0.379960575