McDonnell Genome Institute

Washington University

Transcript

lnc-RTL6-7:1

Chromosome

chr22

Gene Name

lnc-RTL6-7

Start

44434405

CPC Label

noncoding

End

44436824

Cancer

CRC

Strand

-

Peptide

YLFLNITR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

35

Open Reading Frame (ORF)

MKTKYLFLNITRRLLLTALPIIQEPDDKDRKIKKA

Conservation Score

0.036

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0217549

PhyloCSF Frame 2 

-4.722

CNTI Index

noncoding

Max Probability

0.6412

PhyloCSF Frame 3

-4.529

CNTI Score

-0.402751483