McDonnell Genome Institute

Washington University

Transcript

lnc-RTL6-4:1

Chromosome

chr22

Gene Name

lnc-RTL6-4

Start

44483494

CPC Label

noncoding

End

44483717

Cancer

EOGC

Strand

-

Peptide

NVQLLSHFISPFTGGIYGR

Modified Peptide

n[145]NVQLLSHFISPFTGGIYGR

Peptide Length

19

ORF Length

72

Open Reading Frame (ORF)

LCGKRVDDKNVQLLSHFISPFTGGIYGRYIIGLCGKKQKEITEAIKRAQIMGFMPVTYKDLHISRTLKFVIS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.00693692

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4286

PhyloCSF Frame 3

0

CNTI Score

-0.5340353