McDonnell Genome Institute

Washington University

Transcript

lnc-RTL1-8:5

Chromosome

chr14

Gene Name

lnc-RTL1-8

Start

101462945

CPC Label

noncoding

End

101475790

Cancer

LUAD

Strand

-

Peptide

ESFGLQK

Modified Peptide

n[230]ESFGLQK

Peptide Length

7

ORF Length

142

Open Reading Frame (ORF)

LLVPGGGGCSELRSHHCTPAWATRAKLCLKKKKKKESFGLQKVRHHHSIIGTGIQDAGPRYIQGSIPLLSILPIGFSYRPLVFPGCWLAPIPALPWMLACPYTSTATDVGLPLYQHCSGCRLVPTRSLARLVTPGTMCPPLA

Conservation Score

0.158

PhyloCSF Frame 1

0

No. of Spectra

17

CPC Coding Probability

0.129579

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9944

PhyloCSF Frame 3

0

CNTI Score

-0.298606992