McDonnell Genome Institute

Washington University

Transcript

lnc-RTL1-5:1

Chromosome

chr14

Gene Name

lnc-RTL1-5

Start

101332512

CPC Label

noncoding

End

101334869

Cancer

OV

Strand

-

Peptide

DLIHHVAPQILSGTR

Modified Peptide

n[145]DLIHHVAPQILSGTR

Peptide Length

15

ORF Length

33

Open Reading Frame (ORF)

MDLIHHVAPQILSGTRLDVKINQINAFSACAAQ

Conservation Score

0.021

PhyloCSF Frame 1

-6.184

No. of Spectra

1

CPC Coding Probability

0.0282065

PhyloCSF Frame 2 

-5.047

CNTI Index

noncoding

Max Probability

0.1036

PhyloCSF Frame 3

-5.029

CNTI Score

-0.364395527