McDonnell Genome Institute

Washington University

Transcript

lnc-RTL1-3:12

Chromosome

chr14

Gene Name

lnc-RTL1-3

Start

101072808

CPC Label

noncoding

End

101077656

Cancer

HCC

Strand

-

Peptide

KTTVPVNDK

Modified Peptide

n[230]KTTVPVNDK

Peptide Length

9

ORF Length

68

Open Reading Frame (ORF)

LYPPIKSVAHSSPLQLPQLRSQRSRVPRKPGSGMEAAEERVWEVEARYKKTTVPVNDKGWILTQVLRL

Conservation Score

0.64

PhyloCSF Frame 1

-4.879

No. of Spectra

4

CPC Coding Probability

0.436241

PhyloCSF Frame 2 

-3.03

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-4.644

CNTI Score

-0.284788877