McDonnell Genome Institute

Washington University

Transcript

lnc-RTKN2-1:1

Chromosome

chr10

Gene Name

lnc-RTKN2-1

Start

62092763

CPC Label

noncoding

End

62096941

Cancer

OSCC

Strand

-

Peptide

QLAASEVFVFMILWYVGQFHSLDK

Modified Peptide

n[145]QLAASEVFVFMILWYVGQFHSLDK

Peptide Length

24

ORF Length

83

Open Reading Frame (ORF)

LKFLKYLCSPQICPLDSVVIRQLAASEVFVFMILWYVGQFHSLDKVSTMLNIFTEPNTSKQSIWLGKQCISSFNYAIYEEQNP

Conservation Score

1

PhyloCSF Frame 1

-4.397

No. of Spectra

20

CPC Coding Probability

0.098671

PhyloCSF Frame 2 

-3.642

CNTI Index

noncoding

Max Probability

0.8393

PhyloCSF Frame 3

-4.636

CNTI Score

-0.365561938