McDonnell Genome Institute

Washington University

Transcript

lnc-RTCB-2:1

Chromosome

chr22

Gene Name

lnc-RTCB-2

Start

32356675

CPC Label

noncoding

End

32356988

Cancer

CCRC

Strand

-

Peptide

LLCLMSGFYPGAVTVAWK

Modified Peptide

n[272]LLCLMSGFYPGAVTVAWK

Peptide Length

18

ORF Length

79

Open Reading Frame (ORF)

LLCLMSGFYPGAVTVAWKANSTPVTQGTEVTKTSKQSNKHTARSDLSLTPDQWRSCSSYSCKVTHKRALWRRQWPLKNV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

67

CPC Coding Probability

0.129851

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

0

CNTI Score

-0.309531574