McDonnell Genome Institute

Washington University

Transcript

lnc-RTCA-2:1

Chromosome

chr1

Gene Name

lnc-RTCA-2

Start

100249086

CPC Label

noncoding

End

100249317

Cancer

OV

Strand

+

Peptide

RVGMICGADIEVQGK

Modified Peptide

n[145]RVGMICGADIEVQGK

Peptide Length

15

ORF Length

54

Open Reading Frame (ORF)

MCQCLVLRLGEREGSAGEMVMGHSLGDKRVGMICGADIEVQGKRVTPSCSVLRK

Conservation Score

0.03

PhyloCSF Frame 1

-5.193

No. of Spectra

3

CPC Coding Probability

0.0874149

PhyloCSF Frame 2 

-4.096

CNTI Index

noncoding

Max Probability

0.8539

PhyloCSF Frame 3

-1.97

CNTI Score

-0.356329968