McDonnell Genome Institute

Washington University

Transcript

lnc-RSPH14-7:1

Chromosome

chr22

Gene Name

lnc-RSPH14-7

Start

22812680

CPC Label

noncoding

End

22813847

Cancer

PRAD

Strand

-

Peptide

TQLLWQQDGK

Modified Peptide

Peptide Length

10

ORF Length

81

Open Reading Frame (ORF)

LQCFCQTFYLWTTECFTHHDGIPQGALTKELISQQINSNHGPILMAFKCLTIFTNVASGLYEWLSVCLKTQLLWQQDGKNM

Conservation Score

0.272

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0291875

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

0

CNTI Score

-0.347363997