McDonnell Genome Institute

Washington University

Transcript

lnc-RSPH14-1:1

Chromosome

chr22

Gene Name

lnc-RSPH14-1

Start

22821747

CPC Label

noncoding

End

22878603

Cancer

BRCA-Luminal B

Strand

-

Peptide

LGPGEPEEQETK

Modified Peptide

n[145]LGPGEPEEQETK

Peptide Length

12

ORF Length

120

Open Reading Frame (ORF)

LGPGEPEEQETKDQPRGPCGPFPGGITCALSEEGEEEQSPGHGGDVLRALPPETPALGLPGTCGWDPVKGTRSTNQGHSPEPESAAPNPAPPTHEQVTCPSQPLVLSLINGDHRVRSAYR

Conservation Score

0.993

PhyloCSF Frame 1

0

No. of Spectra

40

CPC Coding Probability

0.024348

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

0.671304967