McDonnell Genome Institute

Washington University

Transcript

lnc-RSPH10B2-2:1

Chromosome

chr7

Gene Name

lnc-RSPH10B2-2

Start

7177951

CPC Label

noncoding

End

7178324

Cancer

OV

Strand

+

Peptide

SLQESHPFLVDFFRK

Modified Peptide

n[145]SLQESHPFLVDFFRK

Peptide Length

15

ORF Length

41

Open Reading Frame (ORF)

LGALKDKYLDWAYQSGGYKKAGAVFKSLQESHPFLVDFFRK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00662019

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1701

PhyloCSF Frame 3

0

CNTI Score

-0.43717773