McDonnell Genome Institute

Washington University

Transcript

lnc-RSPH10B2-1:3

Chromosome

chr7

Gene Name

lnc-RSPH10B2-1

Start

6710125

CPC Label

noncoding

End

6753861

Cancer

OSCC

Strand

+

Peptide

TFSNQMEHCLQIFFLYVCMR

Modified Peptide

n[145]TFSNQM[147]EHCLQIFFLYVCMR

Peptide Length

20

ORF Length

76

Open Reading Frame (ORF)

LLLKKNTHHTHLKVILRTFSNQMEHCLQIFFLYVCMRSCVCVQARTHFIKIRTLGLGMVAHACDRSTLGGRGRQIT

Conservation Score

0.875

PhyloCSF Frame 1

-3.121

No. of Spectra

8

CPC Coding Probability

0.0547208

PhyloCSF Frame 2 

-2.72

CNTI Index

noncoding

Max Probability

0.3457

PhyloCSF Frame 3

-1.317

CNTI Score

-0.353458013