McDonnell Genome Institute

Washington University

Transcript

lnc-RSPH1-7:3

Chromosome

chr21

Gene Name

lnc-RSPH1-7

Start

42518423

CPC Label

noncoding

End

42534652

Cancer

OV

Strand

-

Peptide

ILGSQSCLLLWSPAK

Modified Peptide

n[145]ILGSQSCLLLWSPAK

Peptide Length

15

ORF Length

40

Open Reading Frame (ORF)

LRIYIFNVVIYSEGSFPQVTKILGSQSCLLLWSPAKVGVK

Conservation Score

0.05

PhyloCSF Frame 1

-4.982

No. of Spectra

13

CPC Coding Probability

0.325869

PhyloCSF Frame 2 

-5.05

CNTI Index

noncoding

Max Probability

0.9727

PhyloCSF Frame 3

-3.17

CNTI Score

-0.328291153