McDonnell Genome Institute

Washington University

Transcript

lnc-RSPH1-6:1

Chromosome

chr21

Gene Name

lnc-RSPH1-6

Start

42629957

CPC Label

noncoding

End

42636766

Cancer

PRAD

Strand

-

Peptide

ILLGAECHEMLHTK

Modified Peptide

ILLGAECHEMLHTK

Peptide Length

14

ORF Length

97

Open Reading Frame (ORF)

LSRSFTSPPSTTPVATGVSLASKWRRGGQAQLAEGLAVGYTSEKWGPRYCHPAGDPQRQCRRKILLGAECHEMLHTKVGLAESTIACLQTHGQWQKR

Conservation Score

0.061

PhyloCSF Frame 1

-4.702

No. of Spectra

1

CPC Coding Probability

0.368766

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5989

PhyloCSF Frame 3

-3.511

CNTI Score

-0.286273584