McDonnell Genome Institute

Washington University

Transcript

lnc-RSPH1-3:2

Chromosome

chr21

Gene Name

lnc-RSPH1-3

Start

42648302

CPC Label

noncoding

End

42651244

Cancer

OV

Strand

-

Peptide

AGQVDTQTSPVQSCSLVLNSLGGEGSR

Modified Peptide

n[145]AGQVDTQTSPVQSCSLVLNSLGGEGSR

Peptide Length

27

ORF Length

159

Open Reading Frame (ORF)

LPSCSLQPFKGLHDPMHTGRHLLATVHHCKRWSQPEAPHRLPQKQRIPSYWASRAGQVDTQTSPVQSCSLVLNSLGGEGSRSGACSVPPTSAPGSPGILNLHPCSWPGCRECSQCSFLRIKIKTKGTSCLCQAGRRPGWGPRVGSRLGSLGGDEAGDPG

Conservation Score

0.578

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.280713

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1099

PhyloCSF Frame 3

0

CNTI Score

-0.31955548