McDonnell Genome Institute

Washington University

Transcript

lnc-RRN3-3:5

Chromosome

chr16

Gene Name

lnc-RRN3-3

Start

15104722

CPC Label

coding

End

15131601

Cancer

OV

Strand

-

Peptide

QDRLGPGLRYHGPR

Modified Peptide

n[145]QDRLGPGLRYHGPR

Peptide Length

14

ORF Length

97

Open Reading Frame (ORF)

MCCVPGDLHGHGRHPAQAGPVGCQPGPRHPLLWAAGPLQVRDPRQDRLGPGLRYHGPRGHHAVWGGQPERPPAPGWRQSLPPQQPGHLPDRHPAQPG

Conservation Score

1

PhyloCSF Frame 1

7.338

No. of Spectra

85

CPC Coding Probability

1

PhyloCSF Frame 2 

5.827

CNTI Index

coding

Max Probability

0.8222

PhyloCSF Frame 3

-3.152

CNTI Score

0.869512868