McDonnell Genome Institute

Washington University

Transcript

lnc-RRM2B-7:2

Chromosome

chr8

Gene Name

lnc-RRM2B-7

Start

101785855

CPC Label

noncoding

End

101790969

Cancer

OV

Strand

-

Peptide

YEIQENNSALMAK

Modified Peptide

n[145]YEIQENNSALM[147]AK

Peptide Length

13

ORF Length

45

Open Reading Frame (ORF)

LLLLLLLFPGAAEHGLLNLALLLSETIFQRYEIQENNSALMAKSQ

Conservation Score

1

PhyloCSF Frame 1

-2.258

No. of Spectra

2

CPC Coding Probability

0.170724

PhyloCSF Frame 2 

4.01

CNTI Index

noncoding

Max Probability

0.4611

PhyloCSF Frame 3

8.845

CNTI Score

-0.38492036