McDonnell Genome Institute

Washington University

Transcript

lnc-RRM1-5:1

Chromosome

chr11

Gene Name

lnc-RRM1-5

Start

4075047

CPC Label

noncoding

End

4076499

Cancer

OV

Strand

+

Peptide

IGLSVFFLLICK

Modified Peptide

n[145]IGLSVFFLLICK

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

LIWESLLILKIGLSVFFLLICKHYLYILDISLLSI

Conservation Score

0.877

PhyloCSF Frame 1

-5.179

No. of Spectra

1

CPC Coding Probability

0.00737314

PhyloCSF Frame 2 

-4.059

CNTI Index

noncoding

Max Probability

0.8746

PhyloCSF Frame 3

-3.581

CNTI Score

-0.493753501