McDonnell Genome Institute

Washington University

Transcript

lnc-RREB1-5:1

Chromosome

chr6

Gene Name

lnc-RREB1-5

Start

7080280

CPC Label

noncoding

End

7081460

Cancer

OV

Strand

+

Peptide

LGYMQPVINSFMK

Modified Peptide

n[145]LGYM[147]QPVINSFMK

Peptide Length

13

ORF Length

38

Open Reading Frame (ORF)

MKINRDWAGRGGSKRKKKKENQHRLGYMQPVINSFMKF

Conservation Score

0.107

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0228071

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7547

PhyloCSF Frame 3

0

CNTI Score

-0.375507216