McDonnell Genome Institute

Washington University

Transcript

lnc-RRAGC-10:2

Chromosome

chr1

Gene Name

lnc-RRAGC-10

Start

38781166

CPC Label

noncoding

End

38804085

Cancer

HCC

Strand

-

Peptide

QAAWDLVLAVK

Modified Peptide

n[230]QAAWDLVLAVK

Peptide Length

11

ORF Length

51

Open Reading Frame (ORF)

MAQHPGVPELPSLKDAPFQPSGKVRQAAWDLVLAVKAGERSPGCFSIRRGT

Conservation Score

0.6

PhyloCSF Frame 1

-4.811

No. of Spectra

15

CPC Coding Probability

0.202569

PhyloCSF Frame 2 

-5.207

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

-4.195

CNTI Score

-0.353594401