McDonnell Genome Institute

Washington University

Transcript

lnc-RPTOR-1:1

Chromosome

chr17

Gene Name

lnc-RPTOR-1

Start

80542202

CPC Label

noncoding

End

80542605

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

GIDNRVGR

Modified Peptide

n[145]GIDNRVGR

Peptide Length

8

ORF Length

96

Open Reading Frame (ORF)

MAALRPPVKPKIIKKRTKKFIRHQSDRCVTIKRNWQKPRGIDNRVGRRFKGQILMPNIGYGSNKKTKHTLPTGFWKFSLQRQGAGSAADVQHFLLR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.416791

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.556

PhyloCSF Frame 3

0

CNTI Score

-0.318686581