McDonnell Genome Institute

Washington University

Transcript

lnc-RPS6-2:1

Chromosome

chr9

Gene Name

lnc-RPS6-2

Start

19383216

CPC Label

noncoding

End

19383887

Cancer

CCRC

Strand

-

Peptide

DFFMFLSK

Modified Peptide

n[230]DFFMFLSK

Peptide Length

8

ORF Length

42

Open Reading Frame (ORF)

MTGVLKRDHWPCGIGCMRESTGEAKNIVYKDFFMFLSKSLKM

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0193214

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

0

CNTI Score

-0.399914435