McDonnell Genome Institute

Washington University

Transcript

lnc-RPS4Y2-1:1

Chromosome

chrY

Gene Name

lnc-RPS4Y2-1

Start

20727253

CPC Label

coding

End

20742900

Cancer

HCC

Strand

+

Peptide

ASTQLMLR

Modified Peptide

n[230]ASTQLMLR

Peptide Length

8

ORF Length

143

Open Reading Frame (ORF)

MGMLRFLPTKPQSFGPMSLRCSLVPGTVSDLLASKSEDSTAKIWNLNENGNRASTQLMLRHRIPEGAMTSQVTKMSDVISLDWNSDGTLLATGSYDGFARIWTENGNLTSTSGQHKGPIFALKWSKKRELYFEYWCGQKHRQQ

Conservation Score

1

PhyloCSF Frame 1

6.528

No. of Spectra

7

CPC Coding Probability

0.839336

PhyloCSF Frame 2 

5.633

CNTI Index

noncoding

Max Probability

0.9821

PhyloCSF Frame 3

6.176

CNTI Score

-0.300169231