McDonnell Genome Institute

Washington University

Transcript

lnc-RPS4Y1-6:1

Chromosome

chrY

Gene Name

lnc-RPS4Y1-6

Start

1401768

CPC Label

noncoding

End

1403493

Cancer

OV

Strand

+

Peptide

RWEDAGWSAEK

Modified Peptide

n[145]RWEDAGWSAEK

Peptide Length

11

ORF Length

40

Open Reading Frame (ORF)

LPLHSLWASRGERQRWRPMEETHWKSCRRWEDAGWSAEKD

Conservation Score

0.024

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0679586

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4341

PhyloCSF Frame 3

0

CNTI Score

-0.324664813