McDonnell Genome Institute

Washington University

Transcript

lnc-RPS3A-2:1

Chromosome

chr4

Gene Name

lnc-RPS3A-2

Start

151027089

CPC Label

noncoding

End

151027617

Cancer

EOGC

Strand

+

Peptide

SLLVPDHVITYLMMSELENR

Modified Peptide

n[145]SLLVPDHVITYLM[147]M[147]SELENR

Peptide Length

20

ORF Length

79

Open Reading Frame (ORF)

MAKQYIEKSLLVPDHVITYLMMSELENRCGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKRSSQPPLDSPS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.346497

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4346

PhyloCSF Frame 3

0

CNTI Score

-0.390752603