McDonnell Genome Institute

Washington University

Transcript

lnc-RPS27A-1:15

Chromosome

chr2

Gene Name

lnc-RPS27A-1

Start

55314161

CPC Label

noncoding

End

55315525

Cancer

HCC

Strand

+

Peptide

VAVFHSLPCALSK

Modified Peptide

n[230]VAVFHSLPCALSK

Peptide Length

13

ORF Length

67

Open Reading Frame (ORF)

LTALPRMGLFYALFQIKSVFSSRKVAVFHSLPCALSKLPGTGTREGEEEWEEPQDKMPQTTTVPSQG

Conservation Score

0.847

PhyloCSF Frame 1

-4.648

No. of Spectra

5

CPC Coding Probability

0.0439626

PhyloCSF Frame 2 

-4.357

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

-4.2

CNTI Score

-0.402134896