McDonnell Genome Institute

Washington University

Transcript

lnc-RPS27-2:1

Chromosome

chr1

Gene Name

lnc-RPS27-2

Start

153992205

CPC Label

noncoding

End

153995947

Cancer

EOGC

Strand

+

Peptide

IVYLYTKMDGK

Modified Peptide

n[145]IVYLYTKM[147]DGK

Peptide Length

11

ORF Length

108

Open Reading Frame (ORF)

LGHGRCLQALRMVQRLTYQRRLSYNTASNKTRLSQTLGNRIVYLYTKMDGKAPKSACGMCPGRLQGIRAVKPEVLTRLSKTTCRVPCVLNVFVTGSSVLSLSRSRKLL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.221367

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5571

PhyloCSF Frame 3

0

CNTI Score

-0.391683627