McDonnell Genome Institute

Washington University

Transcript

lnc-RPS25-1:22

Chromosome

chr11

Gene Name

lnc-RPS25-1

Start

118984270

CPC Label

noncoding

End

118998002

Cancer

BRCA-Basal-like

Strand

-

Peptide

MPILLSLK

Modified Peptide

n[145]MPILLSLK

Peptide Length

8

ORF Length

73

Open Reading Frame (ORF)

MPILLSLKITPSFFFFFFLRRSLTLLPRLECNGMISSHCNLRLSGSSDSPASASRVAGIISTHHHVQLIFVFL

Conservation Score

0.23

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.397073

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8742

PhyloCSF Frame 3

0

CNTI Score

-0.329834376