McDonnell Genome Institute

Washington University

Transcript

lnc-RPS24-3:12

Chromosome

chr10

Gene Name

lnc-RPS24-3

Start

78179184

CPC Label

noncoding

End

78542627

Cancer

PRAD

Strand

+

Peptide

ASSKSHLSNTVESLSPRGLLER

Modified Peptide

‚Äč

Peptide Length

22

ORF Length

93

Open Reading Frame (ORF)

LLRHQQFTAATVLASSMHCSTTTRASSKSHLSNTVESLSPRGLLERVWGDPRKCTDHALRSTVLDTVGDARKSRGDSKQGPLCIQPALLSAQQ

Conservation Score

0.061

PhyloCSF Frame 1

-5.071

No. of Spectra

4

CPC Coding Probability

0.125612

PhyloCSF Frame 2 

-4.726

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

-4.753

CNTI Score

-0.418974484