McDonnell Genome Institute

Washington University

Transcript

lnc-RPS24-3:11

Chromosome

chr10

Gene Name

lnc-RPS24-3

Start

78179173

CPC Label

noncoding

End

78527338

Cancer

OSCC

Strand

+

Peptide

EERLGGDEMR

Modified Peptide

n[145]EERLGGDEMR

Peptide Length

10

ORF Length

37

Open Reading Frame (ORF)

LGLSSGKDLESGGMKESREERLGGDEMRGQLFSPHSR

Conservation Score

0.235

PhyloCSF Frame 1

-5.536

No. of Spectra

2

CPC Coding Probability

0.0981516

PhyloCSF Frame 2 

-2.791

CNTI Index

noncoding

Max Probability

0.3204

PhyloCSF Frame 3

-4.655

CNTI Score

-0.413145566