McDonnell Genome Institute

Washington University

Transcript

lnc-RPS24-3:10

Chromosome

chr10

Gene Name

lnc-RPS24-3

Start

78179170

CPC Label

noncoding

End

78214082

Cancer

OV

Strand

+

Peptide

LGLSSGKDLESGGMK

Modified Peptide

n[145]LGLSSGKDLESGGMK

Peptide Length

15

ORF Length

62

Open Reading Frame (ORF)

LGLSSGKDLESGGMKESREERLGDEETESQRSRGTGSEMYSMALLEPAWKTSSLPPIAHCFL

Conservation Score

0.89

PhyloCSF Frame 1

-5.536

No. of Spectra

7

CPC Coding Probability

0.159215

PhyloCSF Frame 2 

-4.219

CNTI Index

noncoding

Max Probability

0.8904

PhyloCSF Frame 3

-4.655

CNTI Score

-0.360540782